Human IL9 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-9

Clear
SKU: 00119-IL9 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL9 /

ENCODED PROTEIN NAME:

Interleukin-9 (UniProt: http://www.uniprot.org/uniprot/P15248)

Function:

Supports IL-2 independent and IL-4 independent growth of helper T-cells.

Protein Sequence (144aa):

MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Gene Coding Sequence:

For the IL9 DNA coding sequence will be used as the template for synthesis of the IL9 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg