Human IL7 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-7

Clear
SKU: 00117-IL7 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL7 /

ENCODED PROTEIN NAME:

Interleukin-7 (UniProt: http://www.uniprot.org/uniprot/P13232)

Function:

Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.

Protein Sequence (177aa):

MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Gene Coding Sequence:

For the IL7 DNA coding sequence will be used as the template for synthesis of the IL7 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg