Human IL32 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-32

Clear
SKU: 00143-IL32 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL32 / NK4 TAIF

ENCODED PROTEIN NAME:

Interleukin-32 (UniProt: http://www.uniprot.org/uniprot/P24001)

Function:

Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.

Protein Sequence (234aa):

MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK

Gene Coding Sequence:

For the IL32 DNA coding sequence will be used as the template for synthesis of the IL32 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg