Human IL31 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-31

Clear
SKU: 00142-IL31 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL31 /

ENCODED PROTEIN NAME:

Interleukin-31 (UniProt: http://www.uniprot.org/uniprot/Q6EBC2)

Function:

Activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR (PubMed:15184896). May function in skin immunity (PubMed:15184896). Enhances myeloid progenitor cell survival in vitro (By similarity). Induces RETNLA and serum amyloid A protein expression in macrophages (By similarity).

Protein Sequence (164aa):

MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT

Gene Coding Sequence:

For the IL31 DNA coding sequence will be used as the template for synthesis of the IL31 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg