Human IL3 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-3

Clear
SKU: 00113-IL3 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL3 /

ENCODED PROTEIN NAME:

Interleukin-3 (UniProt: http://www.uniprot.org/uniprot/P08700)

Function:

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Protein Sequence (152aa):

MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Gene Coding Sequence:

For the IL3 DNA coding sequence will be used as the template for synthesis of the IL3 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg