Human IL24 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-24

Clear
SKU: 00134-IL24 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL24 / MDA7 ST16

ENCODED PROTEIN NAME:

Interleukin-24 (UniProt: http://www.uniprot.org/uniprot/Q13007)

Function:

Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation.

Protein Sequence (206aa):

MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Gene Coding Sequence:

For the IL24 DNA coding sequence will be used as the template for synthesis of the IL24 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg