Human IL23A mRNA Mimetic

$1,550.00$2,025.00

Interleukin-23 subunit alpha

Clear
SKU: 00133-IL23A Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL23A / SGRF

ENCODED PROTEIN NAME:

Interleukin-23 subunit alpha (UniProt: http://www.uniprot.org/uniprot/Q9NPF7)

Function:

Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.

Protein Sequence (189aa):

MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Gene Coding Sequence:

For the IL23A DNA coding sequence will be used as the template for synthesis of the IL23A mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg