Human IL22 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-22

Clear
SKU: 00132-IL22 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL22 / ILTIF ZCYTO18

ENCODED PROTEIN NAME:

Interleukin-22 (UniProt: http://www.uniprot.org/uniprot/Q9GZX6)

Function:

Cytokine that contributes to the inflammatory response in vivo.

Protein Sequence (179aa):

MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Gene Coding Sequence:

For the IL22 DNA coding sequence will be used as the template for synthesis of the IL22 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg