Human IL21 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-21

Clear
SKU: 00131-IL21 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL21 /

ENCODED PROTEIN NAME:

Interleukin-21 (UniProt: http://www.uniprot.org/uniprot/Q9HBE4)

Function:

Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.

Protein Sequence (155aa):

MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Gene Coding Sequence:

For the IL21 DNA coding sequence will be used as the template for synthesis of the IL21 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg