Human IL20 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-20

Clear
SKU: 00130-IL20 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL20 / ZCYTO10

ENCODED PROTEIN NAME:

Interleukin-20 (UniProt: http://www.uniprot.org/uniprot/Q9NYY1)

Function:

Proinflammatory and angiogenic cytokine that may be involved in epidermal function and psoriasis. Angiogenic and proliferative activities are antagonized by IL10. May act through STAT3.

Protein Sequence (176aa):

MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE

Gene Coding Sequence:

For the IL20 DNA coding sequence will be used as the template for synthesis of the IL20 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg