Human IL1B mRNA Mimetic

$1,550.00$2,025.00

Interleukin-1 beta

Clear
SKU: 00111-IL1B Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL1B / IL1F2

ENCODED PROTEIN NAME:

Interleukin-1 beta (UniProt: http://www.uniprot.org/uniprot/P01584)

Function:

Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.

Protein Sequence (269aa):

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Gene Coding Sequence:

For the IL1B DNA coding sequence will be used as the template for synthesis of the IL1B mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg