Human IL19 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-19

Clear
SKU: 00129-IL19 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL19 / ZMDA1

ENCODED PROTEIN NAME:

Interleukin-19 (UniProt: http://www.uniprot.org/uniprot/Q9UHD0)

Function:

May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis (By similarity).

Protein Sequence (177aa):

MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

Gene Coding Sequence:

For the IL19 DNA coding sequence will be used as the template for synthesis of the IL19 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg