Human IL17A mRNA Mimetic

$1,550.00$2,025.00

Interleukin-17A

Clear
SKU: 00127-IL17A Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL17A / CTLA8 IL17

ENCODED PROTEIN NAME:

Interleukin-17A (UniProt: http://www.uniprot.org/uniprot/Q16552)

Function:

Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in inducing stromal cells to produce proinflammatory and hematopoietic cytokines (PubMed:8676080).

Protein Sequence (155aa):

MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Gene Coding Sequence:

For the IL17A DNA coding sequence will be used as the template for synthesis of the IL17A mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg