Human IL15 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-15

Clear
SKU: 00125-IL15 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL15 /

ENCODED PROTEIN NAME:

Interleukin-15 (UniProt: http://www.uniprot.org/uniprot/P40933)

Function:

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

Protein Sequence (162aa):

MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Gene Coding Sequence:

For the IL15 DNA coding sequence will be used as the template for synthesis of the IL15 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg