Human IL12A mRNA Mimetic

$1,550.00$2,025.00

Interleukin-12 subunit alpha

Clear
SKU: 00122-IL12A Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL12A / NKSF1

ENCODED PROTEIN NAME:

Interleukin-12 subunit alpha (UniProt: http://www.uniprot.org/uniprot/P29459)

Function:

Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.

Protein Sequence (219aa):

MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Gene Coding Sequence:

For the IL12A DNA coding sequence will be used as the template for synthesis of the IL12A mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg