Human IL11 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-11

Clear
SKU: 00121-IL11 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL11 /

ENCODED PROTEIN NAME:

Interleukin-11 (UniProt: http://www.uniprot.org/uniprot/P20809)

Function:

Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production (PubMed:2145578). Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation (PubMed:12919066). Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.

Protein Sequence (199aa):

MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Gene Coding Sequence:

For the IL11 DNA coding sequence will be used as the template for synthesis of the IL11 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg