Human IL10 mRNA Mimetic

$1,550.00$2,025.00

Interleukin-10

Clear
SKU: 00120-IL10 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IL10 /

ENCODED PROTEIN NAME:

Interleukin-10 (UniProt: http://www.uniprot.org/uniprot/P22301)

Function:

Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Protein Sequence (178aa):

MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Gene Coding Sequence:

For the IL10 DNA coding sequence will be used as the template for synthesis of the IL10 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg