Human IFNL1 mRNA Mimetic

$1,550.00$2,025.00

Interferon lambda-1

Clear
SKU: 00140-IFNL1 Category:

Description

GENE NAME (BOLD) / SYNONYMS:

IFNL1 / IL29 ZCYTO21

ENCODED PROTEIN NAME:

Interferon lambda-1 (UniProt: http://www.uniprot.org/uniprot/Q8IU54)

Function:

Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression.

Protein Sequence (200aa):

MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Gene Coding Sequence:

For the IFNL1 DNA coding sequence will be used as the template for synthesis of the IFNL1 mimetic, please send request to PhaRNA customer service: customerservice@pharna.com

Additional information

Amounts Available

0.5 mg, 1 mg